PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun007845
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family CO-like
Protein Properties Length: 310aa    MW: 33714.7 Da    PI: 7.3513
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-24982PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box27.37.7e-09446440
   zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
               + C+ +++  ++l+C+ +  +lC  C ++ H        H +v
  Vun007845  4 KLCDSCKSATATLYCRPDAAFLCGACDSKVHAAnklasrHPRV 46
               68*****************************656666667665 PP

2zf-B_box22.52.3e-074790441
   zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                 C+ +e+ +++  C+ +   lC  C   +H+       H++ p
  Vun007845 47 ALCEVCEQAPAHVTCKADAAALCLACDRDIHSAnplasrHERLP 90
               68*****************************6688888898876 PP

3CCT70.83.4e-24253296144
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Vun007845 253 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRS 296
                9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.665148IPR000315B-box-type zinc finger
SMARTSM003361.1E-13148IPR000315B-box-type zinc finger
PfamPF006433.7E-7446IPR000315B-box-type zinc finger
CDDcd000218.40E-9548No hitNo description
PROSITE profilePS5011910.6234491IPR000315B-box-type zinc finger
PfamPF006436.7E-64791IPR000315B-box-type zinc finger
SMARTSM003365.5E-94991IPR000315B-box-type zinc finger
PROSITE profilePS5101716.787253295IPR010402CCT domain
PfamPF062034.3E-18253295IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MASKLCDSCK SATATLYCRP DAAFLCGACD SKVHAANKLA SRHPRVALCE VCEQAPAHVT  60
CKADAAALCL ACDRDIHSAN PLASRHERLP VAPFYESVHS VKASSPINFL DDHRFFSDAD  120
ADVSTEEAEA ASWLLPTPKT DLNSSQYLFS ESEPVPYIDL DYAVADPKAD PKGSATADGV  180
VPVQSNYEPF AYGYKYNSTT LSQSQSQMSQ SVSSSSMEVG VVPDGNTMSE ISNCSYSKVA  240
AVTVTAQFSA ADREARVLRY REKRKNRKFE KTIRYASRKA YAETRPRIKG RFAKRSDADP  300
LSGYGVVPSC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014502470.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4-like
SwissprotQ940T91e-108COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A0S3RBH90.0A0A0S3RBH9_PHAAN; Uncharacterized protein
STRINGGLYMA04G06240.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.15e-98CONSTANS-like 4